Loading...
Statistics
Advertisement

Pallimattathu Bagavathy
www.pallimattathamma.com/

Pallimattathamma.com

Advertisement
Conversion Technology Metas Server
Pallimattathamma.com is hosted in Singapore . Pallimattathamma.com doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: Html, Javascript, Swf Object, Number of used javascripts: 1. First javascripts: AC_RunActiveContent.js, Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.0.

Technologies in use by Pallimattathamma.com

Technology

Number of occurences: 3
  • Html
  • Javascript
  • Swf Object

Advertisement

Javascripts

Number of occurences: 1
  • AC_RunActiveContent.js

Server Type

  • Microsoft-IIS/7.0

Powered by

  • ASP.NET

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Pallimattathamma.com

Missing HTTPS protocol.

    Meta - Pallimattathamma.com

    Number of occurences: 1
    • Name:
      Content: text/html; charset=utf-8

    Server / Hosting

    • IP: 182.50.130.158
    • Latitude: 1.37
    • Longitude: 103.80
    • Country: Singapore

    Rname

    • ns68.domaincontrol.com
    • ns67.domaincontrol.com
    • smtp.secureserver.net
    • mailstore1.secureserver.net

    Target

    • dns.jomax.net

    HTTP Header Response

    HTTP/1.1 200 OK Content-Type: text/html Last-Modified: Fri, 03 Apr 2015 05:23:44 GMT Accept-Ranges: bytes ETag: "31f695ace6dd01:0" Server: Microsoft-IIS/7.0 X-Powered-By: ASP.NET Date: Thu, 18 Aug 2016 22:35:17 GMT Content-Length: 1410 X-Cache: MISS from s_ub9 X-Cache-Lookup: MISS from s_ub9:80 Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive

    DNS

    host: pallimattathamma.com
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 182.50.130.158
    host: pallimattathamma.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns68.domaincontrol.com
    host: pallimattathamma.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns67.domaincontrol.com
    host: pallimattathamma.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns67.domaincontrol.com
    5. rname: dns.jomax.net
    6. serial: 2016050400
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 600
    host: pallimattathamma.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 0
    5. target: smtp.secureserver.net
    host: pallimattathamma.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mailstore1.secureserver.net

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.allimattathamma.com, www.piallimattathamma.com, www.iallimattathamma.com, www.pkallimattathamma.com, www.kallimattathamma.com, www.puallimattathamma.com, www.uallimattathamma.com, www.pjallimattathamma.com, www.jallimattathamma.com, www.plallimattathamma.com, www.lallimattathamma.com, www.pllimattathamma.com, www.paollimattathamma.com, www.pollimattathamma.com, www.papllimattathamma.com, www.ppllimattathamma.com, www.pa9llimattathamma.com, www.p9llimattathamma.com, www.pallimattathamma.com, www.pllimattathamma.com, www.paillimattathamma.com, www.pillimattathamma.com, www.paullimattathamma.com, www.pullimattathamma.com, www.palimattathamma.com, www.palulimattathamma.com, www.paulimattathamma.com, www.pal8limattathamma.com, www.pa8limattathamma.com, www.pal9limattathamma.com, www.pa9limattathamma.com, www.paljlimattathamma.com, www.pajlimattathamma.com, www.pal0limattathamma.com, www.pa0limattathamma.com, www.palmlimattathamma.com, www.pamlimattathamma.com, www.palplimattathamma.com, www.paplimattathamma.com, www.palolimattathamma.com, www.paolimattathamma.com, www.palimattathamma.com, www.palluimattathamma.com, www.paluimattathamma.com, www.pall8imattathamma.com, www.pal8imattathamma.com, www.pall9imattathamma.com, www.pal9imattathamma.com, www.palljimattathamma.com, www.paljimattathamma.com, www.pall0imattathamma.com, www.pal0imattathamma.com, www.pallmimattathamma.com, www.palmimattathamma.com, www.pallpimattathamma.com, www.palpimattathamma.com, www.palloimattathamma.com, www.paloimattathamma.com, www.pallmattathamma.com, www.pallirmattathamma.com, www.pallrmattathamma.com, www.pallifmattathamma.com, www.pallfmattathamma.com, www.pallivmattathamma.com, www.pallvmattathamma.com, www.pallikmattathamma.com, www.pallkmattathamma.com, www.palli,mattathamma.com, www.pall,mattathamma.com, www.pallibmattathamma.com, www.pallbmattathamma.com, www.palligmattathamma.com, www.pallgmattathamma.com, www.pallitmattathamma.com, www.palltmattathamma.com, www.palliymattathamma.com, www.pallymattathamma.com, www.palliumattathamma.com, www.pallumattathamma.com, www.pallijmattathamma.com, www.palljmattathamma.com, www.pallimmattathamma.com, www.pallmmattathamma.com, www.pallinmattathamma.com, www.pallnmattathamma.com, www.palliattathamma.com, www.pallimpattathamma.com, www.pallipattathamma.com, www.pallimoattathamma.com, www.pallioattathamma.com, www.pallimiattathamma.com, www.palliiattathamma.com, www.pallimkattathamma.com, www.pallikattathamma.com, www.pallim.attathamma.com, www.palli.attathamma.com, www.pallimuattathamma.com, www.palliuattathamma.com, www.pallimjattathamma.com, www.pallijattathamma.com, www.pallimnattathamma.com, www.pallinattathamma.com, www.pallim-attathamma.com, www.palli-attathamma.com, www.pallimttathamma.com, www.pallimaottathamma.com, www.pallimottathamma.com, www.pallimapttathamma.com, www.pallimpttathamma.com, www.pallima9ttathamma.com, www.pallim9ttathamma.com, www.pallimattathamma.com, www.pallimttathamma.com, www.pallimaittathamma.com, www.pallimittathamma.com, www.pallimauttathamma.com, www.pallimuttathamma.com, www.pallimatathamma.com, www.pallimatqtathamma.com, www.pallimaqtathamma.com, www.pallimatatathamma.com, www.pallimaatathamma.com, www.pallimat tathamma.com, www.pallima tathamma.com, www.pallimatwtathamma.com, www.pallimawtathamma.com, www.pallimatetathamma.com, www.pallimaetathamma.com, www.pallimatztathamma.com, www.pallimaztathamma.com, www.pallimatxtathamma.com, www.pallimaxtathamma.com, www.pallimatctathamma.com, www.pallimactathamma.com, www.pallimatathamma.com, www.pallimattqathamma.com, www.pallimatqathamma.com, www.pallimattaathamma.com, www.pallimataathamma.com, www.pallimatt athamma.com, www.pallimat athamma.com, www.pallimattwathamma.com, www.pallimatwathamma.com, www.pallimatteathamma.com, www.pallimateathamma.com, www.pallimattzathamma.com, www.pallimatzathamma.com, www.pallimattxathamma.com, www.pallimatxathamma.com, www.pallimattcathamma.com, www.pallimatcathamma.com, www.pallimattthamma.com, www.pallimattaothamma.com, www.pallimattothamma.com, www.pallimattapthamma.com, www.pallimattpthamma.com, www.pallimatta9thamma.com, www.pallimatt9thamma.com, www.pallimattathamma.com, www.pallimattthamma.com, www.pallimattaithamma.com, www.pallimattithamma.com, www.pallimattauthamma.com, www.pallimattuthamma.com,

    Other websites we recently analyzed

    1. Hochzeitfotografie - nancybeygang-photographys Webseite!
      Hochzeitsfotografie und Portrait. Unterwegs bin ich in Bamberg, Franken, Leipzig, Worms, Mannheim, Altenburg, Erlangen, Nürnberg.
      Dublin (Ireland) - 52.211.38.225
      Server software: nginx
      Technology: CSS, Html, Html5, Javascript, Php, Google Analytics
      Number of Javascript: 1
      Number of meta tags: 3
    2. claudius.name
      Germany - 217.160.223.45
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    3. q45545.cn
      China - 124.16.31.152
      Server software: Tengine/1.4.2
      Technology: Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1
    4. Home - Canoeing, Kayaking, Cornwall Canoe Trips, Kayak Hire, River Fowey, Cornwall Kayak Holiday
      Encounter Cornwall has been running guided canoe trips and kayak hire on the Fowey Estuary since 2006. Our trips are an ideal introduction to kayaking on the Fowey’s sheltered tidal waters, and are suitable for both families and those new to kayaking.
      United Kingdom - 94.229.166.7
      G Analytics ID: UA-61227501-1
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Flexslider, Html, Javascript, jQuery Fancybox, Php, Google Analytics, Facebook Box, Share This Social Media Buttons
      Number of Javascript: 7
      Number of meta tags: 4
    5. Mamasita Bar & Grill
      Best Mexican Food in New York & Hell's Kitchen. Fresh Mexican food in 10019. Gluten free. No MSG, no Animal Fat, and no LARD.
      Scottsdale (United States) - 198.71.232.3
      Server software: DPS/0.2.7
      Technology: CSS, Html, Html5, Javascript
      Number of Javascript: 2
      Number of meta tags: 4
    6. sveltos.com
      Houston (United States) - 192.185.92.110
      Server software: nginx/1.10.0
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 6
      Number of meta tags: 5
    7. Ãœber uns | cairos-academy
      Germany - 78.47.220.105
      Server software: Apache
      Technology: CSS, Html
      Number of meta tags: 1
    8. miscmannamagalginknimatnyasvetchargapoleaz
      San Francisco (United States) - 192.0.78.13
      Server software: nginx
      Technology: Skimlinks, CSS, Gravatar, Html, Html5, Javascript, Php, Pingback, Shortcodes, comScore, Wordpress, Twitter Button
      Number of Javascript: 8
      Number of meta tags: 7
    9. ¿Ã‹Ã‚¡ÍõվȺ ÁªÏµQQ£º1785605588
      Kansas City (United States) - 173.208.215.148
      Server software: Microsoft-IIS/6.0
      Technology: Html
      Number of meta tags: 1
    10. Restaurant La Ripaille
      Le restaurant La Ripaille est situé à Arromanches, nous vous proposons une cuisine Normande traditionnelle.
      France - 213.186.33.104
      G Analytics ID: UA-441859-8
      Server software: Apache
      Technology: Carousel, CSS, Html, Html5, Iframe, Javascript, Google Analytics
      Number of Javascript: 2
      Number of meta tags: 4

    Check Other Websites